DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstE1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:189 Identity:81/189 - (42%)
Similarity:110/189 - (58%) Gaps:4/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPC-RSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            ||| |:|.:|.|.:.::...|.:||||||||..|::|.|||||:|.|.|||..:|:|.||..|||
  Fly    14 SPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLV 78

  Fly    75 EKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYP-QVFAKAPADPEAFKKIEAAFEFL 138
            :||.|:|.||||...|||::||||:||...:|.|.||...| .:........|....:....:.|
  Fly    79 DKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLL 143

  Fly   139 NTFLEGQDYAAGDSLTVADIALVATVSTFEVA-KFEISKYANVNRWYENAKKVTPGWEE 196
            .|||....|.||||||:||::...|||....| ..:.:.|..|..|.:...|: |.::|
  Fly   144 ETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKL-PYYKE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 34/64 (53%)
GstA 4..185 CDD:223698 78/176 (44%)
GST_C_Delta_Epsilon 89..205 CDD:198287 38/110 (35%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 34/64 (53%)
GstA 8..197 CDD:223698 79/183 (43%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460245
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.