DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and clic4

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:203 Identity:50/203 - (24%)
Similarity:74/203 - (36%) Gaps:71/203 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VELNKK---LLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPK 86
            |:|.:|   |.||..|.|  |.|:..|.:  :.|.|:.         |:.||      .|.|   
Zfish    56 VDLKRKPADLQNLAPGTH--PPFITFNGE--VKTDVNK---------IEEYL------EDIL--- 98

  Fly    87 CPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPA-----DPEAFKKIEAAFEFLNTFLEGQD 146
            ||.|        |..:|..:.. :|.....:|||..|     .|:|.:.:|..  .|.|..:..:
Zfish    99 CPPK--------YSKLGARHPE-SNTAGMDIFAKFSAFIKNSKPDANEALERG--LLKTLQKLDE 152

  Fly   147 YAA------------------------GDSLTVADIALVATVSTFE-VAK----FEISK-YANVN 181
            |..                        |:.:|:||..|:..:...: |||    |||.| ...:.
Zfish   153 YLCSPLPDEIDHNSMEEVKASTRMFLDGEEMTLADCNLLPKLHIVKVVAKKYRGFEIPKDLTGIW 217

  Fly   182 RWYENAKK 189
            |:..||.|
Zfish   218 RYLNNAYK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 16/52 (31%)
GstA 4..185 CDD:223698 47/197 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 30/136 (22%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 21/76 (28%)
O-ClC 16..250 CDD:129941 50/203 (25%)
GST_C_CLIC4 110..250 CDD:198329 27/119 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.