Sequence 1: | NP_001034042.1 | Gene: | GstD1 / 41503 | FlyBaseID: | FBgn0001149 | Length: | 209 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_958894.1 | Gene: | clic4 / 368255 | ZFINID: | ZDB-GENE-030326-3 | Length: | 252 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 50/203 - (24%) |
---|---|---|---|
Similarity: | 74/203 - (36%) | Gaps: | 71/203 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 VELNKK---LLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPK 86
Fly 87 CPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPA-----DPEAFKKIEAAFEFLNTFLEGQD 146
Fly 147 YAA------------------------GDSLTVADIALVATVSTFE-VAK----FEISK-YANVN 181
Fly 182 RWYENAKK 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD1 | NP_001034042.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 16/52 (31%) |
GstA | 4..185 | CDD:223698 | 47/197 (24%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 30/136 (22%) | ||
clic4 | NP_958894.1 | GST_N_CLIC | 13..103 | CDD:239359 | 21/76 (28%) |
O-ClC | 16..250 | CDD:129941 | 50/203 (25%) | ||
GST_C_CLIC4 | 110..250 | CDD:198329 | 27/119 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589429 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |