| Sequence 1: | NP_001034042.1 | Gene: | GstD1 / 41503 | FlyBaseID: | FBgn0001149 | Length: | 209 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_956370.1 | Gene: | mars1 / 338183 | ZFINID: | ZDB-GENE-030219-83 | Length: | 922 | Species: | Danio rerio |
| Alignment Length: | 201 | Identity: | 42/201 - (20%) |
|---|---|---|---|
| Similarity: | 70/201 - (34%) | Gaps: | 49/201 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 GSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTL----VDNGFALWESRAI 69
Fly 70 QVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAA 134
Fly 135 ------FEFLNTFLEGQ--DYAAGDSLTVADIALVATV------STFEVAKFEISKYANVNRWYE 185
Fly 186 NAKKVT 191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstD1 | NP_001034042.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 16/69 (23%) |
| GstA | 4..185 | CDD:223698 | 40/193 (21%) | ||
| GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 25/117 (21%) | ||
| mars1 | NP_956370.1 | GstA | 1..173 | CDD:223698 | 41/195 (21%) |
| GST_N_family | 1..67 | CDD:238319 | 14/67 (21%) | ||
| GST_C_MetRS_N | 75..176 | CDD:198340 | 23/113 (20%) | ||
| PRK12268 | 261..820 | CDD:237029 | |||
| MetRS_core | 263..631 | CDD:173907 | |||
| Anticodon_Ia_Met | 640..769 | CDD:153411 | |||
| MetRS_RNA | 866..910 | CDD:238475 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||