Sequence 1: | NP_001034042.1 | Gene: | GstD1 / 41503 | FlyBaseID: | FBgn0001149 | Length: | 209 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997847.1 | Gene: | clic1 / 324481 | ZFINID: | ZDB-GENE-030131-3202 | Length: | 241 | Species: | Danio rerio |
Alignment Length: | 240 | Identity: | 46/240 - (19%) |
---|---|---|---|
Similarity: | 78/240 - (32%) | Gaps: | 108/240 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 GSSP-CRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLK-INPQHTIPTLVDNGFALWESRAIQV 71
Fly 72 YLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQ--------------VFAKAP 122
Fly 123 A-----DPE-----------AFKKIEAAFEFLN--------------------TFLEGQDYAAGD 151
Fly 152 SLTVADIALVATVSTFEVA--KFEISKYANVNRWYENAKKVTPGW 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD1 | NP_001034042.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 16/67 (24%) |
GstA | 4..185 | CDD:223698 | 44/229 (19%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 27/158 (17%) | ||
clic1 | NP_997847.1 | GST_N_CLIC | 3..93 | CDD:239359 | 20/106 (19%) |
O-ClC | 6..241 | CDD:129941 | 46/240 (19%) | ||
GST_C_CLIC1 | 100..238 | CDD:198333 | 24/126 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589633 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |