DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Gsto2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:177 Identity:39/177 - (22%)
Similarity:68/177 - (38%) Gaps:57/177 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLPGSSPCRSVIMTAKAVGVE-LNKKLLNLQAGEHLKPE-FLKINPQHTIPTLVDNGFAL-WESR 67
            :.|.|...| :::.||::..| :|..|.|       ||: :...:|...:|.|.::...| :||.
  Rat    31 FCPYSHRTR-LVLKAKSIRHEIININLKN-------KPDWYYTKHPFGQVPVLENSQCQLIYESV 87

  Fly    68 AIQVYLVEKY-GKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAP--------- 122
            ....||.:.: |:  .|:|..|.:||  .|::..::               |.|.|         
  Rat    88 IACEYLDDVFPGR--KLFPYDPYERA--RQKMLLEL---------------FCKVPQLSKECLVA 133

  Fly   123 ------------ADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVAD 157
                        |..:....:|...|:.||...|     |||:::.|
  Rat   134 LRCGRDCTDLKVALRQELCNLEEILEYQNTTFFG-----GDSISMID 175

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/71 (27%)
GstA 4..185 CDD:223698 39/177 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 16/90 (18%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 18/70 (26%)