DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTT2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens


Alignment Length:157 Identity:50/157 - (31%)
Similarity:78/157 - (49%) Gaps:8/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            |.|.|:|.:.||..|:.|..:.::|..|:|...|||:||....:|||.|..|.|.||.||.:||.
Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75

  Fly    75 EKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIE------- 132
            .||...|..||...:.||.:::.|.:....:..:|....:.||...........:|:|       
Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMD 140

  Fly   133 AAFEFL-NTFLEGQDYAAGDSLTVADI 158
            .|.::| :.||..:.:.||..:|:||:
Human   141 QALQWLEDKFLGDRPFLAGQQVTLADL 167

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 28/64 (44%)
GstA 4..185 CDD:223698 50/157 (32%)
GST_C_Delta_Epsilon 89..205 CDD:198287 17/78 (22%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 28/66 (42%)
GstA 14..210 CDD:223698 48/154 (31%)