DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTT1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:162 Identity:47/162 - (29%)
Similarity:82/162 - (50%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            |.|||:|.:.||...:....::::|..|:||...|.::||...:|.|.|..|.|.||.||.:||.
Human    11 SQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLT 75

  Fly    75 EKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQS-----FANYYYPQVFAKAPADPE----AFKK 130
            .||...|..||:..:.||.:::.|.:...||.:|     :....:| ||...|..|:    ...:
Human    76 RKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFP-VFLGEPVSPQTLAATLAE 139

  Fly   131 IEAAFEFL-NTFLEGQDYAAGDSLTVADIALV 161
            ::...:.| :.||:.:.:..|..:::||:..:
Human   140 LDVTLQLLEDKFLQNKAFLTGPHISLADLVAI 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/64 (39%)
GstA 4..185 CDD:223698 47/162 (29%)
GST_C_Delta_Epsilon 89..205 CDD:198287 17/83 (20%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 25/66 (38%)