DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Clic2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:212 Identity:53/212 - (25%)
Similarity:85/212 - (40%) Gaps:53/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSSP-CRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLK-INPQHTIPTLVDNGFALWESRAIQV 71
            |:.| |:.:.|.....||:.|...::...    |||.|| :.|....|.|:.|.    |.:...:
  Rat    28 GNCPFCQRLFMILWLKGVKFNVTTIDTAR----KPEELKDLAPGTNPPFLIYNK----ELKTDFI 84

  Fly    72 YLVEKYGKT--DSLYPKCPKKRAVINQRLYFDMG-TLYQSFANYYYPQVFAKAPADPEAFKKIEA 133
            .:.|...||  ...||....|     .:..||:| .|:..|:.|.       .....||.|..|.
  Rat    85 KIEEFLEKTLAPPRYPHLSPK-----YKESFDVGCNLFAKFSAYI-------KNTQKEANKNFEK 137

  Fly   134 AF--------EFLNT-FLEGQD-------------YAAGDSLTVADIALVATVSTFEVA-----K 171
            :.        ::||| .|:..|             :..||.||:||.:|:..::..:||     .
  Rat   138 SLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRD 202

  Fly   172 FEI-SKYANVNRWYENA 187
            |:| ::::.|.|:..||
  Rat   203 FDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 17/67 (25%)
GstA 4..185 CDD:223698 51/208 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 31/128 (24%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 20/75 (27%)
GST_N_CLIC 9..99 CDD:239359 20/78 (26%)
O-ClC 12..245 CDD:129941 53/212 (25%)
GST_C_CLIC2 106..244 CDD:198331 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.