DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstE9

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:186 Identity:72/186 - (38%)
Similarity:110/186 - (59%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            |.:..|.|.|:..:|..|:|::...:|:||.||||...||...|||||:|.|.|:|..:|||.||
  Fly     7 YGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAI 71

  Fly    70 QVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQS-FANYYYPQVFAKAPADPEAFKKIEA 133
            ..|||.:|.|:|.||||...|||:::|||:|:.|.|:|. ..|...|..:......|.:  :|:|
  Fly    72 CAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRS--QIDA 134

  Fly   134 ---AFEFLNTFLEGQDYAAGDSLTVADIALVATVSTF-EVAKFEISKYANVNRWYE 185
               |::||..|:..|.|..|..:|:||.::|::||:. .:|..:..:|..:|.|.:
  Fly   135 IYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 32/69 (46%)
GstA 4..185 CDD:223698 72/184 (39%)
GST_C_Delta_Epsilon 89..205 CDD:198287 32/102 (31%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 72/186 (39%)
GST_N_Delta_Epsilon 4..76 CDD:239343 31/68 (46%)
GST_C_Delta_Epsilon 92..209 CDD:198287 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460240
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.