powered by:
Protein Alignment GstD1 and AIMP3
DIOPT Version :9
Sequence 1: | NP_001034042.1 |
Gene: | GstD1 / 41503 |
FlyBaseID: | FBgn0001149 |
Length: | 209 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_660194.1 |
Gene: | AIMP3 / 246507 |
FlyBaseID: | FBgn0050185 |
Length: | 179 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 17/70 - (24%) |
Similarity: | 34/70 - (48%) |
Gaps: | 7/70 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 APADPEAF--KKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISK--YANVN 181
||...:.: |::.|.| |.....:.|..|..:|:||:|:...:.....:...:.| |.|::
Fly 83 APGSKDKYVSKQLLADF---NKLFASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLS 144
Fly 182 RWYEN 186
||:::
Fly 145 RWFDH 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.