DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstT2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:211 Identity:51/211 - (24%)
Similarity:91/211 - (43%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLN---------LQAGEHLKPEFLKINPQHTIPTLV 57
            :.|||         .:::..|.|:.:..|..|         |:..|.|..|:.|||....:|.:|
  Fly     5 IRFYY---------DLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIV 60

  Fly    58 DNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYY-----YPQV 117
            ...|.|.|:.||..||.:|....:.||||..:.||.:::.|.:....:..:.:.|:     :|..
  Fly    61 GGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMN 125

  Fly   118 FAKAPADPEAFKKIEAAFEFLNT--------FLEGQDYAAGDSLTVADIALVATVSTFEVAKFEI 174
            .......||   :|:|..|.:..        :|| .|:..|.:||:|||...:.::...:.::.:
  Fly   126 GIAPKPKPE---QIQALIEGVENNLGLLERLWLE-NDFLVGKNLTMADILGSSEINQLRLCQYRV 186

  Fly   175 --SKYANVNRWYENAK 188
              .|:..|.:|.|..:
  Fly   187 DEKKFPKVVKWLERVR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/81 (28%)
GstA 4..185 CDD:223698 50/204 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 23/115 (20%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 23/83 (28%)
GstA 7..202 CDD:223698 51/207 (25%)
GST_C_family 93..218 CDD:295467 23/114 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.