DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstD1 and Vars

DIOPT Version :9

Sequence 1:	NP_001034042.1	Gene:	GstD1 / 41503	FlyBaseID:	FBgn0001149	Length:	209	Species:	Drosophila melanogaster
Sequence 2:	NP_035820.3	Gene:	Vars / 22321	MGIID:	90675	Length:	1263	Species:	Mus musculus

Alignment Length:	107	Identity:	30/107 - (28%)
Similarity:	43/107 - (40%)	Gaps:	26/107 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   115 PQVFAKAPA-DPE-AFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALV-ATVSTFEVAKFEISK 176
            |.:..:.|. ||: |...:..|...|..:|....|.|||:.|:||:|.| |.:..|.......::
Mouse   117 PALGLRGPGQDPQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSAR 181

  Fly   177 --YANVNRW-------------------YENAKKVT--PGWE 195
              :.||.||                   |..|:.||  ||.|
Mouse   182 RIWGNVTRWFNTCVRQPEFRAVLGEVALYSGARSVTQQPGSE 223

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstD1	NP_001034042.1	GST_N_Delta_Epsilon	2..75	CDD:239343
		GstA	4..185	CDD:223698	23/93 (25%)
		GST_C_Delta_Epsilon	89..205	CDD:198287	30/107 (28%)
Vars	NP_035820.3	GST_C_family	92..213	CDD:383119	24/95 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	218..294		3/6 (50%)
		PTZ00419	281..1263	CDD:240411
		'HIGH' region	343..353
		'KMSKS' region	861..865
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0625
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810