DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and eef1g

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:151 Identity:40/151 - (26%)
Similarity:68/151 - (45%) Gaps:14/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEFLKINPQHTIPTLV-DNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTL 105
            |.||...|...:|... |:||.|:||.||..||     ..|.|....|:..|.:.|.:.|....:
Zfish    47 PAFLGNFPLGKVPAYQGDDGFCLFESNAIAHYL-----SNDVLRGSTPQASAQVLQWVSFADSEV 106

  Fly   106 YQSFANYYYPQV----FAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVST 166
            ....:.:.:|.:    |.| .|..:|.::::.....||..|..:.:..|:.:::|||.:|.::..
Zfish   107 IPPASAWVFPTLGIMQFNK-QATEQAKEEVKRVLAVLNQHLNTRTFLVGERISLADITVVCSLLW 170

  Fly   167 FEVAKFEIS---KYANVNRWY 184
            ......|::   .|.||.||:
Zfish   171 LYKQVLELAFRQPYPNVTRWF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/33 (45%)
GstA 4..185 CDD:223698 40/151 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/103 (21%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 15/39 (38%)
maiA 5..201 CDD:273527 40/151 (26%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 22/102 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.