DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gst-43

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:164 Identity:49/164 - (29%)
Similarity:69/164 - (42%) Gaps:45/164 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRA--------------- 92
            ||:|.||...:||||.||.:|.||.||..||.|.|.....| ||...||:               
 Worm    46 EFVKHNPAKKVPTLVINGLSLTESLAIIEYLDEAYPDPPFL-PKELDKRSYSRAIALHIVASIQP 109

  Fly    93 --------VINQRLYFDMGTLYQSF-ANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYA 148
                    ::|::   :.|  |..| .|::..:.|.   |..|..||            ....|.
 Worm   110 LQAINIHKMLNEK---EPG--YGDFWCNHFVNKGFL---ALEELLKK------------HSGKYC 154

  Fly   149 AGDSLTVADIALVATVSTFEVAKFEISKYANVNR 182
            .||.||:|||.|.:.:...::.|.::|||..:.|
 Worm   155 VGDQLTIADINLPSIIYNAKIYKVDMSKYPTITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/31 (58%)
GstA 4..185 CDD:223698 49/164 (30%)
GST_C_Delta_Epsilon 89..205 CDD:198287 26/118 (22%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 17/30 (57%)
maiA 5..211 CDD:273527 49/164 (30%)
GST_C_Zeta 90..207 CDD:198300 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163422
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.