DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Y53G8B.1

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:30 Identity:12/30 - (40%)
Similarity:16/30 - (53%) Gaps:5/30 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFFSHLLLIKCGTGSIVQKCLDGPRPLLDE 65
            :|.||..|    :|.||.:|..| .||.:|
 Worm   446 LFMSHTAL----SGKIVLRCAIG-APLTEE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343 12/30 (40%)
GST_C_Delta_Epsilon 89..205 CDD:198287
Y53G8B.1NP_497662.1 maiA 18..211 CDD:273527
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.