DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:197 Identity:51/197 - (25%)
Similarity:80/197 - (40%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLPGSSPCRSVIMTA---KAVGVELNK-KLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWES 66
            |...||.|.|.:.||   |.:..|... .|||.|.    :.||...||...:|.|..||..|.||
 Worm     8 YSSWSSGCSSRVRTALALKKIDYEYQPVNLLNKQK----EQEFHGNNPAEKVPILKINGLTLTES 68

  Fly    67 RAIQVYLVEKYGKTDSLYPKCPKKRA---------------VINQRLYFDMGTLYQSFANYYYPQ 116
            .||..||.|.| ....|.||.|:.:|               :.|:.:|..:......:.:::...
 Worm    69 MAIIEYLDEIY-PDPPLLPKEPELKARARAIAFHIASNIQPLQNKPIYLMLNEKEPGYGDFWCQH 132

  Fly   117 VFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATV-STFEVAKFEISKYANV 180
            ..:|      .||.:|...:     :...|:..|:.:::|||.|.:.| :..|....:::.|..:
 Worm   133 FISK------GFKALEELLQ-----MHSGDFCVGNQISIADICLPSIVYNAIEKYHVDMTPYPII 186

  Fly   181 NR 182
            .|
 Worm   187 TR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 28/72 (39%)
GstA 4..185 CDD:223698 51/197 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 17/110 (15%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 27/71 (38%)
maiA 18..211 CDD:273527 46/187 (25%)
GST_C_Zeta 89..207 CDD:198300 18/111 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.