DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gst-42

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:188 Identity:53/188 - (28%)
Similarity:80/188 - (42%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPCRSVIMTAKAV-GVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            |.|...:..|.|: .|:...|.::| ..|..|.:..:|||...:||.|.:|..:.||.||..||.
 Worm    14 SSCSWRVRIALALKNVDYEYKTVDL-LSEEAKSKLKEINPAAKVPTFVVDGQVITESLAIIEYLE 77

  Fly    75 EKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAF--EF 137
            |.:... .|.||.|.|||.. :.:...:.:..|...|....|:          ..|.||.|  :|
 Worm    78 ETHPDV-PLLPKDPIKRAHA-RAISLLVASGIQPLHNLKVLQL----------LNKKEAGFGGQF 130

  Fly   138 LNTF-LEG------------QDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNR 182
            ...| :||            ..||.||.:|:||:::...:.:......::|.|..|||
 Worm   131 AKQFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSPYPTVNR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/64 (34%)
GstA 4..185 CDD:223698 53/188 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 26/109 (24%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 21/63 (33%)
maiA 7..211 CDD:273527 53/188 (28%)
GST_C_Zeta 90..207 CDD:198300 27/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.