DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Gsto1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:179 Identity:50/179 - (27%)
Similarity:72/179 - (40%) Gaps:50/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PGSSP--------------CRSVIMTAKAVGVE---LNKKLLNLQAGEHLKPE-FLKINPQHTIP 54
            ||..|              .:..:|..||.|:.   :|..|.|       ||| |.:.||...:|
Mouse    16 PGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKN-------KPEWFFEKNPLGLVP 73

  Fly    55 TLVDN-GFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVF 118
            .|.:: |..:.||.....||.|.|.: ..|:|..|.|:|  .|::     || :||:.  .|.:.
Mouse    74 VLENSQGHLVTESVITCEYLDEAYPE-KKLFPDDPYKKA--RQKM-----TL-ESFSK--VPPLI 127

  Fly   119 AK---------APADPEA----FKKIEAAFEFLNTFLEGQDYAAGDSLT 154
            |.         :|...||    |||:|...:...:||.|...:..|.||
Mouse   128 ASFVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLT 176

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/85 (27%)
GstA 4..185 CDD:223698 50/179 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/79 (28%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 22/84 (26%)
GstA 26..224 CDD:223698 47/169 (28%)