| Sequence 1: | NP_001034042.1 | Gene: | GstD1 / 41503 | FlyBaseID: | FBgn0001149 | Length: | 209 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_034397.1 | Gene: | Gdap1 / 14545 | MGIID: | 1338002 | Length: | 358 | Species: | Mus musculus |
| Alignment Length: | 259 | Identity: | 51/259 - (19%) |
|---|---|---|---|
| Similarity: | 88/259 - (33%) | Gaps: | 100/259 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 VIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKT 80
Fly 81 DSLYPKCPKKRAVINQRLYFDMGTLYQSFANYY------------------YPQ--VFAKAPA-- 123
Fly 124 ---------------------DP---EAF--------------------KKI----EAAFEFLNT 140
Fly 141 FLE----------GQDYAAGDSLTVADIALVATVSTFEVAKFE-----ISKYANVNRWYENAKK 189 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstD1 | NP_001034042.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 16/58 (28%) |
| GstA | 4..185 | CDD:223698 | 48/253 (19%) | ||
| GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 33/186 (18%) | ||
| Gdap1 | NP_034397.1 | GST_N_GDAP1 | 26..98 | CDD:239350 | 15/57 (26%) |
| GST_C_GDAP1 | 179..289 | CDD:198336 | 23/107 (21%) | ||
| Required for mitochondrial localization. /evidence=ECO:0000250 | 320..358 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167844780 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||