DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and AIMP3

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:XP_061501516.1 Gene:AIMP3 / 1275730 VectorBaseID:AGAMI1_003941 Length:180 Species:Anopheles gambiae


Alignment Length:104 Identity:25/104 - (24%)
Similarity:53/104 - (50%) Gaps:6/104 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSL 153
            ||.:|  ::.:.|..|..|......|..:|. ||::.:. ...::..:.||.:|:.:.|...|:|
Mosquito    55 KKSSV--RQAHSDFETECQILQWLDYAVLFV-APSNKDK-HTAKSLLDELNFYLQSRSYLVNDTL 115

  Fly   154 TVADIALVATV--STFEVAKFEISKYANVNRWYENAKKV 190
            :|||:.:..|:  :...:...|...:.||:||:.:.:::
Mosquito   116 SVADVVVFHTIHETMANLQPLEKENFLNVSRWFHHLQQL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343
GST_C_Delta_Epsilon 89..205 CDD:198287 25/104 (24%)
AIMP3XP_061501516.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.