DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and LOC1268045

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:XP_306603.4 Gene:LOC1268045 / 1268045 VectorBaseID:AGAMI1_007364 Length:211 Species:Anopheles gambiae


Alignment Length:117 Identity:33/117 - (28%)
Similarity:47/117 - (40%) Gaps:39/117 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NTT------AISSLNRPA-------AAGKPNLGSRSTK--------AVEF-QLESSTELERTLPC 132
            |||      .:|||::.|       |....|:|.|:..        |::. ||:|:.|   .:|.
Mosquito    33 NTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVE---EVPL 94

  Fly   133 ERYPYKLSCKNDTSQPIAKWYFDIQTLSCELYP------FGQCE-DDPLDKL 177
            .....|.:.|:      || .||.|..|....|      :.||: ..|||||
Mosquito    95 TDITRKKAFKS------AK-VFDQQIFSRATMPAPMMDTYAQCDKPPPLDKL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343
GST_C_Delta_Epsilon 89..205 CDD:198287 33/117 (28%)
LOC1268045XP_306603.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.