DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Clic1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_254279.1 Gene:Clic1 / 114584 MGIID:2148924 Length:241 Species:Mus musculus


Alignment Length:180 Identity:34/180 - (18%)
Similarity:63/180 - (35%) Gaps:55/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LW-ESRAIQVYLVEKYGKTDSLYPKCPKKR---AVINQRLYFDMGTLYQSFANYYYPQVFAK-AP 122
            || :.....|..|:...:|:::...||..:   .:....::.|...:.:.......|..:.| |.
Mouse    34 LWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAA 98

  Fly   123 ADPEA-------FKKIEA-------------------AFEFLNTFL---------------EG-- 144
            .:||:       |.|..|                   |.:.|:.:|               ||  
Mouse    99 LNPESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGIS 163

  Fly   145 -QDYAAGDSLTVADIALVATVSTFEVA-----KFEISK-YANVNRWYENA 187
             :.:..|:.||:||..|:..:...:|.     .|.|.: :..|:|:..||
Mouse   164 QRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 3/12 (25%)
GstA 4..185 CDD:223698 32/176 (18%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/153 (18%)
Clic1NP_254279.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 8/55 (15%)
O-ClC 6..241 CDD:129941 34/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.