Sequence 1: | NP_001034042.1 | Gene: | GstD1 / 41503 | FlyBaseID: | FBgn0001149 | Length: | 209 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116132.1 | Gene: | Gsta5 / 100042314 | MGIID: | 3704339 | Length: | 222 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 53/205 - (25%) |
---|---|---|---|
Similarity: | 79/205 - (38%) | Gaps: | 57/205 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 AVGVELNKKLLNLQAGEHLKPEFLKINPQ---HTIPTLVDNGFALWESRAIQVYLVEKYGKTDSL 83
Fly 84 YPKCPKKRAVINQRLYFD--------MGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNT 140
Fly 141 FL---------EGQDYAAGDSLTVADI---ALVATVSTFEVA-----------KFEISKYANVNR 182
Fly 183 WYENAKKVTP 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD1 | NP_001034042.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 18/55 (33%) |
GstA | 4..185 | CDD:223698 | 52/196 (27%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 30/135 (22%) | ||
Gsta5 | NP_001116132.1 | PTZ00057 | 1..198 | CDD:173353 | 52/195 (27%) |
GST_N_Alpha | 4..82 | CDD:239375 | 20/64 (31%) | ||
GST_C_family | 86..220 | CDD:295467 | 30/136 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D485985at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |