DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Gsta5

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001116132.1 Gene:Gsta5 / 100042314 MGIID:3704339 Length:222 Species:Mus musculus


Alignment Length:205 Identity:53/205 - (25%)
Similarity:79/205 - (38%) Gaps:57/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AVGVELNKKLLNLQAGEHLKPEFLKINPQ---HTIPTLVDNGFALWESRAIQVYLVEKYGKTDSL 83
            |.|||..:|.  :|:.|.|  |.||.:..   ..:|.:..:|..|.::|||..|:..||    .|
Mouse    25 AAGVEFEEKF--IQSPEDL--EKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKY----DL 81

  Fly    84 YPKCPKKRAVINQRLYFD--------MGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNT 140
            |.|..|:||:|:  :|.:        :|.|             ...|.|.:..|...|.....|.
Mouse    82 YGKDMKERALID--MYSEGILDLTEMIGQL-------------LICPPDQKEAKTALAKDRTKNR 131

  Fly   141 FL---------EGQDYAAGDSLTVADI---ALVATVSTFEVA-----------KFEISKYANVNR 182
            :|         .||||..|:.||..|:   .|:..|..|:.:           |..||...||.:
Mouse   132 YLPAFEKVLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKK 196

  Fly   183 WYENAKKVTP 192
            :.....:..|
Mouse   197 FLHPGSQRKP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/55 (33%)
GstA 4..185 CDD:223698 52/196 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 30/135 (22%)
Gsta5NP_001116132.1 PTZ00057 1..198 CDD:173353 52/195 (27%)
GST_N_Alpha 4..82 CDD:239375 20/64 (31%)
GST_C_family 86..220 CDD:295467 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485985at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.