Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004271.1 | Gene: | EEF1E1 / 9521 | HGNCID: | 3212 | Length: | 174 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 42/207 - (20%) |
---|---|---|---|
Similarity: | 78/207 - (37%) | Gaps: | 54/207 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 ARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTL-VDDGFAIWESRAILIYLAEKYDKDGSL 83
Fly 84 YPKDPQQRAVINQRLFF------------DLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDA 136
Fly 137 FAMFNTLLKGQQYAALNKLTLADFALLATVSTF--EISEYDFGKYPEVVRWYDNAKKVIPGWEEN 199
Fly 200 WEGCEYYK-KLY 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 13/55 (24%) |
GstA | 4..187 | CDD:223698 | 37/181 (20%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 24/131 (18%) | ||
EEF1E1 | NP_004271.1 | N-terminal | 2..56 | 13/58 (22%) | |
Linker | 57..63 | 2/6 (33%) | |||
C-terminal | 64..152 | 22/119 (18%) | |||
GST_C_AIMP3 | 65..165 | CDD:198338 | 24/131 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |