DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and sspA

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:180 Identity:40/180 - (22%)
Similarity:70/180 - (38%) Gaps:59/180 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYSAPCRSILMTARALGLELNKKQVDLDAGEHLK-----PEFVKINPQHTIPTLVDDGFAIWESR 67
            :||...| |::..:.:..|:          ||::     .:.:.:||..::|||||....:||||
E. coli    20 IYSHQVR-IVLAEKGVSFEI----------EHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESR 73

  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKK 132
            .|:.||.|::... .|.|..|..|.              :|.:|.:               .::|
E. coli    74 IIMEYLDERFPHP-PLMPVYPVARG--------------ESRLYMH---------------RIEK 108

  Fly   133 IDDAFAMFNTLLKG--QQYAALNKLTLADFALLATVSTFEISEYDFGKYP 180
              |.:.:.||::.|  .:..|..|....:...:|.|         ||:.|
E. coli   109 --DWYTLMNTIINGSASEADAARKQLREELLAIAPV---------FGQKP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 40/180 (22%)
sspANP_417696.1 sspA 1..211 CDD:236537 40/180 (22%)

Return to query results.
Submit another query.