DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTO1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:188 Identity:45/188 - (23%)
Similarity:75/188 - (39%) Gaps:33/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KPE-FVKINPQHTIPTLVD-DGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLS 103
            ||| |.|.||...:|.|.: .|..|:||.....||.|.| ....|.|.||.::|.  |::..:|.
Human    59 KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAY-PGKKLLPDDPYEKAC--QKMILELF 120

  Fly   104 TLYQSYVYYY--------YPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADF 160
            :...|.|..:        |..|.|:.:|     ...|:::......|...|.     |.:::.|:
Human   121 SKVPSLVGSFIRSQNKEDYAGLKEEFRK-----EFTKLEEVLTNKKTTFFGG-----NSISMIDY 175

  Fly   161 ALLATVSTFEISEYD--FGKYPEVVRWY-----DNAKKVIPGWEENWEGCEYYKKLYL 211
            .:.......|..:.:  ....|::..|.     |.....:...|::|:|   :.:|||
Human   176 LIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQG---FLELYL 230

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/35 (43%)
GstA 4..187 CDD:223698 38/162 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/132 (16%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 14/34 (41%)