DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Clic5

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:213 Identity:49/213 - (23%)
Similarity:71/213 - (33%) Gaps:71/213 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LELNKKQVDLD---AGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKYDKDGSLYPK 86
            ::|.:|..||.   .|.|  |.|:..|           |....:...|..:|.|....:  .|||
  Rat    54 VDLKRKPADLHNLAPGTH--PPFLTFN-----------GDVKTDVNKIEEFLEETLTPE--KYPK 103

  Fly    87 DPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDN----------LKKIDDAFAMFN 141
            ...:....| ....|:.:.:.:|           :|.....:|          |:|:||   ..|
  Rat   104 LAARHRESN-TAGIDIFSKFSAY-----------IKNTKQQNNAALERGLTKALRKLDD---YLN 153

  Fly   142 TLL------------KGQQYAAL--NKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKV 192
            |.|            ||.|...|  ::|||||..||..:...:|..   .||    |.||...::
  Rat   154 TPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVA---KKY----RNYDIPAEM 211

  Fly   193 IPGWEENWEGCEYYKKLY 210
            ...|       .|.|..|
  Rat   212 TGLW-------RYLKNAY 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 12/52 (23%)
GstA 4..187 CDD:223698 43/188 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 31/141 (22%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 13/56 (23%)
O-ClC 14..249 CDD:129941 49/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.