DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and CLIC3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:220 Identity:44/220 - (20%)
Similarity:68/220 - (30%) Gaps:78/220 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKY 77
            |:.:.|.....|:......||......:..:|.   |...:|.|:.|..|..::..|..:|.|  
Human    25 CQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFA---PGSQLPILLYDSDAKTDTLQIEDFLEE-- 84

  Fly    78 DKDGSLYPKD------------------------------PQQRAVINQRLFFDLSTLYQSYV-- 110
                :|.|.|                              |.|...:.|:|...|:.| .||:  
Human    85 ----TLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARL-DSYLRA 144

  Fly   111 -----YYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFE 170
                 ....|||.|..::..|.|                         :|||||.:||..:...:
Human   145 PLEHELAGEPQLRESRRRFLDGD-------------------------RLTLADCSLLPKLHIVD 184

  Fly   171 ISEYDFGKYP------EVVRWYDNA 189
            .....|.:.|      .|.|:.|:|
Human   185 TVCAHFRQAPIPAELRGVRRYLDSA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 13/61 (21%)
GstA 4..187 CDD:223698 42/216 (19%)
GST_C_Delta_Epsilon 89..207 CDD:198287 26/114 (23%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 15/71 (21%)
PLN02817 5..229 CDD:330276 44/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.