Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004660.2 | Gene: | CLIC3 / 9022 | HGNCID: | 2064 | Length: | 236 | Species: | Homo sapiens |
Alignment Length: | 220 | Identity: | 44/220 - (20%) |
---|---|---|---|
Similarity: | 68/220 - (30%) | Gaps: | 78/220 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 CRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKY 77
Fly 78 DKDGSLYPKD------------------------------PQQRAVINQRLFFDLSTLYQSYV-- 110
Fly 111 -----YYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFE 170
Fly 171 ISEYDFGKYP------EVVRWYDNA 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 13/61 (21%) |
GstA | 4..187 | CDD:223698 | 42/216 (19%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 26/114 (23%) | ||
CLIC3 | NP_004660.2 | Required for insertion into the membrane. /evidence=ECO:0000250 | 1..88 | 15/71 (21%) | |
PLN02817 | 5..229 | CDD:330276 | 44/220 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154442 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |