DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and URE2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:60/224 - (26%)
Similarity:96/224 - (42%) Gaps:44/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMLY---SAPCR-SILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVD---DGFAI 63
            |.|:   |||.. .:.:....||...|...:|.:.|||..||||.:||...:|.|:|   |..:|
Yeast   114 YTLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSI 178

  Fly    64 WESRAILIYLAEKYDKDGS---LYPKDPQQRAVINQRLFFDLS----TLYQS--YVYYYYPQLFE 119
            |||.|||::|..||.|:..   |:..|...::.||..|||..|    .:.|:  :.|::..::..
Yeast   179 WESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIAS 243

  Fly   120 DVKKPADPDN---------LKKIDDAFAMFNTLLKGQQYAA------------------LNKLTL 157
            .|::..|...         |.:..:|..|.........|:|                  .:|||:
Yeast   244 AVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTI 308

  Fly   158 ADFALLATVSTFEISEYDFG-KYPEVVRW 185
            ||.|.:...:..:....:.. ::|||.:|
Yeast   309 ADLAFVPWNNVVDRIGINIKIEFPEVYKW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 30/75 (40%)
GstA 4..187 CDD:223698 60/224 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 25/131 (19%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 32/79 (41%)
GST_C_Ure2p 208..350 CDD:198326 25/130 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2827
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.