DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GTT2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:51/178 - (28%)
Similarity:88/178 - (49%) Gaps:16/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QVDLDAGEHLKPEFVKINPQHTIPTL-VDDGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVI 94
            :::|..|||.||||:..|...|:|.| :|||..|.|..||..|: :..|...:|..|.|.::.||
Yeast    50 RINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEYI-DALDGTPTLTGKTPLEKGVI 113

  Fly    95 ---NQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPD-NLKKIDDA---FAMFNTLLKGQQYAAL 152
               |:|...:|......|.::..|.|..:|:...:.: .|::.|.|   ...|:|:|:.:.|.|.
Yeast   114 HMMNKRAELELLDPVSVYFHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAG 178

  Fly   153 NKLTLADFALLATVSTFEISEYDFGKYPEVVR-WY------DNAKKVI 193
            :..::||..::|.:....|.:....:..|.:| ||      .:.||::
Yeast   179 DSFSMADITVIAGLIFAAIVKLQVPEECEALRAWYKRMQQRPSVKKLL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 20/44 (45%)
GstA 4..187 CDD:223698 49/170 (29%)
GST_C_Delta_Epsilon 89..207 CDD:198287 27/119 (23%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 20/44 (45%)
GST_C_GTT2_like 106..222 CDD:198291 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345136
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.