DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and AT1G57720

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_176084.1 Gene:AT1G57720 / 842147 AraportID:AT1G57720 Length:413 Species:Arabidopsis thaliana


Alignment Length:192 Identity:47/192 - (24%)
Similarity:84/192 - (43%) Gaps:21/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LMTARALGLELNKKQVDLDAG-EHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKYDKD 80
            |:.|...|::: ::..|...| .:..|||:|:||...:|.|......|:||.||..|::.| :.|
plant    18 LIAAEYAGVKI-EESADFQMGVTNKSPEFLKMNPIGKVPVLETPEGPIFESNAIARYVSRK-NGD 80

  Fly    81 GSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQL-FEDVKKPADPDNLKKIDDAFAMFNTLL 144
            .||......:.|.|.|.:.|....:..:.:.::.|:: :.....||:...:..:.......||.|
plant    81 NSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYAPFSAPAEEAAISALKRGLEALNTHL 145

  Fly   145 KGQQYAALNKLTLADFALL-------ATVSTFEISEYDFGKYPEVVRWY------DNAKKVI 193
            ....:...:.:||||...:       |||.|.:.:    ..:|.|.|::      ...|||:
plant   146 ASNTFLVGHSVTLADIVTICNLNLGFATVMTKKFT----SAFPHVERYFWTMVNQPEFKKVL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 44/184 (24%)
AT1G57720NP_176084.1 GST_N_EF1Bgamma 6..77 CDD:239342 19/59 (32%)
GST_C_EF1Bgamma_like 90..210 CDD:198290 24/118 (20%)
EF1G 255..360 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.