DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTF14

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:188 Identity:54/188 - (28%)
Similarity:84/188 - (44%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GLELNKKQVDLDAGEHLKPEFVK-INPQHTIPTLVDDGFAIWESRAILIYLAEKY-DKDGSLYPK 86
            ||:.....||..|||.....|:. :||...:|.|.|....::|.:||..||||:| |...:|.|.
plant    27 GLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNLLPD 91

  Fly    87 DPQQRAVINQRLFFD-------LSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLL 144
            ||::||:::..:..|       .|||.:..:...|..|..|  ..|..:|.:|:.:...::.|.|
plant    92 DPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGLATD--DTAVQENKEKLSEVLNIYETRL 154

  Fly   145 KGQQYAALNKLTLADFALLATVSTF------EISEYDFGKYPEVVRWYDNAKKVIPGW 196
            ....|.|....:|||...||.:...      |:....:.: |.|..|.:. .|:.|.|
plant   155 GESPYLAGESFSLADLHHLAPIDYLLNTDEEELKNLIYSR-PNVAAWVEK-MKMRPAW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/51 (35%)
GstA 4..187 CDD:223698 51/177 (29%)
GST_C_Delta_Epsilon 89..207 CDD:198287 28/121 (23%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 19/52 (37%)
GST_C_Phi 94..214 CDD:198296 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.