DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and clic3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:165 Identity:36/165 - (21%)
Similarity:63/165 - (38%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRSILMTARALGLELNKKQVDLDAGEHLKPEFVK-INPQHTIPTLVDDGFAIWESRAILIYLAEK 76
            |:.:.|.....|:......||:...    ||.:| :.|....|.|:.:|....::..|     |:
Zfish    26 CQRLFMILWLKGVNFTLTTVDMKRA----PEVLKDLAPGSQPPFLIYNGEVRTDTNKI-----EE 81

  Fly    77 YDKDGSLYPKDPQQ--RAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKID----- 134
            :.:|....|:.|:.  |...:.....|:...:.:|:....|.| .|:.:.....:|.|:|     
Zfish    82 FLEDTLAPPQYPKLCCRYKESNTAGDDIFHKFSAYIKNPNPGL-NDMLEKKFLKSLMKLDQYLLT 145

  Fly   135 ------DAFAMFNTLLKGQQYAALNKLTLADFALL 163
                  |.....:|  ..:.|...|.|:|||..||
Zfish   146 PLPHELDQNPELST--STRHYLDGNALSLADCNLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 13/62 (21%)
GstA 4..187 CDD:223698 36/165 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 19/88 (22%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 16/74 (22%)
O-ClC 6..237 CDD:129941 36/165 (22%)
GST_C_CLIC3 99..231 CDD:198332 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.