DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTF6

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:214 Identity:49/214 - (22%)
Similarity:82/214 - (38%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLA 74
            |...|.:|:......::.....|:|..|||.|..|:..||...:|...|..|.|:|||||..|:|
plant    12 STATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIA 76

  Fly    75 EKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYP----QLFEDVKKP----------- 124
            .::...|:......:..|:|...:..:        .:.:.|    .::|.|.||           
plant    77 HEFSDKGNNLLSTGKDMAIIAMGIEIE--------SHEFDPVGSKLVWEQVLKPLYGMTTDKTVV 133

  Fly   125 -ADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG--------KYP 180
             .:...|.|:.|   ::...|...:|.|.:..||.|      :.|..:.:|..|        :.|
plant   134 EEEEAKLAKVLD---VYEHRLGESKYLASDHFTLVD------LHTIPVIQYLLGTPTKKLFDERP 189

  Fly   181 EVVRWY------DNAKKVI 193
            .|..|.      .:|:||:
plant   190 HVSAWVADITSRPSAQKVL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/64 (34%)
GstA 4..187 CDD:223698 46/206 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 25/135 (19%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 22/64 (34%)
GST_C_Phi 91..208 CDD:198296 24/133 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.