DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTF5

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:216 Identity:58/216 - (26%)
Similarity:90/216 - (41%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYL 73
            ||...|.:|......||..:...|:|.||:..||.|:.|||...:|..:|.|..:.|||||..|:
plant    71 YSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRAISEYI 135

  Fly    74 AEKYDKDGSLYPKDPQQRAVINQRLF-------FD--LSTL-YQSYVYYYYPQLFEDVKKPADPD 128
            |..:...|:........:.:..||::       ||  .||| ::..:...| .|..|.|...:.:
plant   136 ATVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMY-GLKTDYKVVNETE 199

  Fly   129 NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTF--EISEYDFGKYPEVVRWYDNAKK 191
              .|::....::...||...:.|.|..|:||...|..:...  ..::..|...|.|.||.... .
plant   200 --AKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDTHTKRMFVNRPSVRRWVAEI-T 261

  Fly   192 VIPGWEENWEGCE----YYKK 208
            ..|.|:   ..|:    |:||
plant   262 ARPAWK---RACDVKAWYHKK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/65 (38%)
GstA 4..187 CDD:223698 52/189 (28%)
GST_C_Delta_Epsilon 89..207 CDD:198287 29/133 (22%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 25/64 (39%)
GST_C_Phi 153..270 CDD:198296 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.