DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTF7

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:217 Identity:55/217 - (25%)
Similarity:82/217 - (37%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLA 74
            |...|.:|:......|:.....::|..|||.|..|:..||...:|...|..|.::|||||..|:|
plant    12 STATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQYIA 76

  Fly    75 EKYDKDG----SLYPKDPQQRAV---INQRLFFDLSTLYQSYVYYYYPQLFEDVKKP-------- 124
            ..|...|    ||..||....|:   |....|..:.:          ..::|.|.||        
plant    77 HFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGS----------KLVWEQVLKPLYGMTTDK 131

  Fly   125 ----ADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG-------- 177
                .:...|.|:.|   ::...|...:|.|.:|.||.|      :.|..:.:|..|        
plant   132 TVVEEEEAKLAKVLD---VYEHRLGESKYLASDKFTLVD------LHTIPVIQYLLGTPTKKLFD 187

  Fly   178 KYPEVVRWY------DNAKKVI 193
            :.|.|..|.      .:||||:
plant   188 ERPHVSAWVADITSRPSAKKVL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/64 (33%)
GstA 4..187 CDD:223698 51/209 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 27/134 (20%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 21/64 (33%)
GST_C_Phi 95..209 CDD:198296 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.