DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTT2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:209 Identity:51/209 - (24%)
Similarity:96/209 - (45%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|....|.|.|::|:..:...::.::..:.|...:.|.|||.:|||...:|.:||....::||
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFES 67

  Fly    67 RAILIYLAEKYDKDGSL----YPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFE-------D 120
            .||||||:..|   .|:    ||.|..:||.|:..|.:..:.|......|....:..       :
plant    68 HAILIYLSSAY---ASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLN 129

  Fly   121 VKKPADPDNLKKIDDAFAMFNTL-LKGQQYAAL--NKLTLADFALLATVSTFEI-SEYD----FG 177
            .|..|:.:|:  :.::.:...|. |||.....|  .:.::||.:|:..:...:: .:.|    ..
plant   130 PKAAAEAENI--LTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRLLS 192

  Fly   178 KYPEVVRWYDNAKK 191
            .:.:|.:|.::.:|
plant   193 PHKKVEQWIESTRK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/72 (35%)
GstA 4..187 CDD:223698 49/201 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/118 (18%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 25/74 (34%)
GST_C_Theta 92..221 CDD:198292 21/117 (18%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.