DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTT3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:216 Identity:59/216 - (27%)
Similarity:97/216 - (44%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|....|.|.|::|:..:...::.::..:.|...:.|.|||..|||...:|.:||....:.||
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSES 67

  Fly    67 RAILIYLAEKYDK-DGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPA--DPD 128
            .||||||:..|.. ....||.|..:||.|:..|.:..:.|......|    :...|..||  .|.
plant    68 HAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGY----VLNSVLGPALGLPL 128

  Fly   129 NLKKIDDAFAM----FNTL----LKGQQYAAL--NKLTLADFALLATVSTFEI-SEYD----FGK 178
            |.|...:|..:    ..||    |||.....|  |:.::||.:|:..::..:: .:.|    ...
plant   129 NPKAAAEAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRLLSP 193

  Fly   179 YPEVVRWYDNAKK-VIPGWEE 198
            :..|.:|.:|.:| .:|.::|
plant   194 HKNVEQWIENTRKATMPHFDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/72 (35%)
GstA 4..187 CDD:223698 54/200 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 30/128 (23%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 55/202 (27%)
GST_N_Theta 3..78 CDD:239348 25/74 (34%)
GST_C_Theta 92..221 CDD:198292 30/127 (24%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.