DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTT1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:219 Identity:60/219 - (27%)
Similarity:102/219 - (46%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|....|.|.|::::..:..|::.::..:.|...:.|.|||..|||...:|.:||....::||
plant     4 LKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFES 68

  Fly    67 RAILIYLAEKYDKDGS-LYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPA--DPD 128
            .||||||:..:..... .||.|..:||.|:..|.:..:.|.:....|    :...|..||  .|.
plant    69 HAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGY----VLNSVLGPALGLPL 129

  Fly   129 NLKKIDDAFAM----FNTL----LKGQQYAAL--NKLTLADFALLATVSTFEI-SEYD----FGK 178
            |.|...:|..:    .:||    |||.....|  |:.::||.:|:..:...:: .:.|    ...
plant   130 NPKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLST 194

  Fly   179 YPEVVRWYDNAKK-VIPGWEENWE 201
            :.:|.:|.:|.|| .:|.::|..|
plant   195 HKKVEQWIENTKKATMPHFDETHE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/72 (35%)
GstA 4..187 CDD:223698 53/200 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 32/131 (24%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 25/74 (34%)
GST_C_Theta 93..223 CDD:198292 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.