DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTF2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:195 Identity:46/195 - (23%)
Similarity:77/195 - (39%) Gaps:27/195 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLA 74
            |...|.:|:......|:.....|:|..|||.|..|:..||...:|...|....::|||||..|:|
plant    12 SIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIA 76

  Fly    75 EKYDKDG-SLYPKDPQQRAVINQRLFFDLSTLYQSYVY------YYYPQLFEDV-----KKPADP 127
            .:|:..| :|...|.:.   |:|.....:....:.:.:      ..:.|:|:.:     .:....
plant    77 HRYENQGTNLLQTDSKN---ISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVA 138

  Fly   128 DNLKKIDDAFAMFNTLLKGQQYAALNKLTLADF-------ALLATVSTFEISEYDFGKYPEVVRW 185
            :...|:.....::...||..:|.|....||.|.       .||.| .|.::    |.:.|.|..|
plant   139 EEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGT-PTKKL----FTERPRVNEW 198

  Fly   186  185
            plant   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/64 (33%)
GstA 4..187 CDD:223698 46/195 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 20/115 (17%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 22/65 (34%)
GST_C_Phi 96..211 CDD:198296 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.