DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:211 Identity:54/211 - (25%)
Similarity:91/211 - (43%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLA 74
            ||....:|:.......|.....|:|.|..|..|.|:.:||...:|.|.||...::|||||..|:|
plant    11 SACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRAITAYIA 75

  Fly    75 EKY-DKDGSL-YPKDPQQRAVINQRLFFDL----------STLYQSYVYYYYPQLFEDVKKPADP 127
            ||: ||...| ..:||::.|::  :|:.::          :.::|..|   .|...|........
plant    76 EKHRDKGTDLTRHEDPKEAAIV--KLWSEVEAHHFNPAISAVIHQLIV---VPLQGESPNAAIVE 135

  Fly   128 DNLKKIDDAFAMFNTLLKGQQYAALNKLTLAD-------FALLATVSTFEISEYDFGKYPEVVRW 185
            :||:.:.....::...|...:|.|.:..||||       :..:.|:....|::     .|.|..|
plant   136 ENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGLIND-----RPNVKAW 195

  Fly   186 YDNA------KKVIPG 195
            :::.      .||.||
plant   196 WEDLCSRPAFLKVSPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/64 (34%)
GstA 4..187 CDD:223698 50/195 (26%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/130 (18%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 51/207 (25%)
GST_N_Phi 2..77 CDD:239351 23/65 (35%)
GST_C_Phi 92..208 CDD:198296 20/125 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_103768
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.