DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gstt4

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:247 Identity:58/247 - (23%)
Similarity:104/247 - (42%) Gaps:51/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |:.|..|.|||||::.:.||..|:..:.:.|||..|.|...|:::|||...:|:|.|..|.:.||
Mouse     3 LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDGKFILSES 67

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQS-----YVYYYYPQL--------- 117
            .|||.||..||......||.|...||.:::.:.:..:.:...     ::....|.:         
Mouse    68 VAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTER 132

  Fly   118 ----FEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGK 178
                .::||:     ||::.::.|      |:.:.:...:.::|||...|..:.....|.::...
Mouse   133 LEKTLDEVKR-----NLQQFEEKF------LQDKMFITGDHISLADLVALVEMMQPMGSNHNVFV 186

  Fly   179 YPEVVRWYDNAKKVIPG---WE--------ENWEG-----------CEYYKK 208
            ..::..|....:..|..   ||        .||:.           |::.:|
Mouse   187 SSKLAEWRMRVELAIGSGLFWEAHERLVKLPNWDCSTLDPTIKMRICDFLQK 238

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 31/72 (43%)
GstA 4..187 CDD:223698 50/200 (25%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/157 (13%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 48/177 (27%)
GST_N_Theta 3..78 CDD:239348 31/74 (42%)