DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gstt4

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:243 Identity:58/243 - (23%)
Similarity:102/243 - (41%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |:.|..|.|||||::.:.||..|:..:.:.|||..|.|...|:::|||...:|:|.|..|.:.||
  Rat     3 LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSES 67

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQS-----YVYYYYPQL------FED 120
            .|||.||..||......||.|...||.:::.:.:..:.:...     ::....|.:      .|.
  Rat    68 VAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTER 132

  Fly   121 VKKPADP--DNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVV 183
            :.|..|.  .|:|:.::.|......:.|      :.::|||...|..:.....:.::.....::.
  Rat   133 LDKTLDEVNKNIKQFEEKFLQDKLFITG------DHISLADLVALVEMMQPMGTNHNVFISSKLA 191

  Fly   184 RW----------------YDNAKKVIPGWE-------ENWEGCEYYKK 208
            .|                :|...| :|.|:       ...:.||:.:|
  Rat   192 EWRMRVELAIGSGLFWEAHDRLVK-LPSWDCSTLDPSIKMKICEFLQK 238

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 31/72 (43%)
GstA 4..187 CDD:223698 50/211 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/153 (14%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 31/74 (42%)