DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gsto2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:96 Identity:26/96 - (27%)
Similarity:44/96 - (45%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YSAPCRSILMTARALGLELNKKQVDLDAGEHLKPE-FVKINPQHTIPTLVDDGF-AIWESRAILI 71
            ||...|.:|   :|.|:......::|.:    ||: :...:|...||.|.:... .::||.....
Mouse    34 YSHRARLVL---KAKGIRHEVININLKS----KPDWYYTKHPFGQIPVLENSQCQLVYESVIACE 91

  Fly    72 YLAEKYDKDGSLYPKDPQQRAVINQRLFFDL 102
            ||.:.| ....|:|.||.:||  .|::..:|
Mouse    92 YLDDVY-PGRKLFPYDPYERA--RQKMLLEL 119

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 17/67 (25%)
GstA 4..187 CDD:223698 26/96 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 4/14 (29%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 16/66 (24%)