DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Eef1g

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_080283.3 Gene:Eef1g / 67160 MGIID:1914410 Length:437 Species:Mus musculus


Alignment Length:195 Identity:46/195 - (23%)
Similarity:83/195 - (42%) Gaps:25/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYSAP----CRSILMTARALGLELNKKQVDLDAGEHL-------KPEFVKINPQHTIPTLV-DDG 60
            ||:.|    ....|:.|:..|.::..    |.|..|.       .|||::..|...:|... |||
Mouse     6 LYTYPENWRAFKALIAAQYSGAQVRV----LSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDG 66

  Fly    61 FAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQL-FEDVKKP 124
            |.::||.||..|::.:     .|....|:..|.:.|.:.|..|.:......:.:|.| .....|.
Mouse    67 FCVFESNAIAYYVSNE-----ELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQ 126

  Fly   125 ADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTF--EISEYDFGK-YPEVVRWY 186
            |..:..:::.....:.:|.||.:.:....::||||..::.|:...  ::.|..|.: :|...||:
Mouse   127 ATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWF 191

  Fly   187  186
            Mouse   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/78 (29%)
GstA 4..187 CDD:223698 46/195 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/102 (21%)
Eef1gNP_080283.3 GST_N_EF1Bgamma 4..82 CDD:239342 23/79 (29%)
GstA 5..202 CDD:223698 46/195 (24%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 21/101 (21%)
FinO_conjug_rep <211..>265 CDD:301594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.