DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Eef1e1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:170 Identity:37/170 - (21%)
Similarity:69/170 - (40%) Gaps:28/170 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTL-VDDGFAIWESRAILIYLAEKYDKDGSL 83
            |.|..|.|.:|.:.|..|.....:     .:..||.| .::|.::.....|..:|.::..|: .|
Mouse     2 AAAAELRLLEKSLGLKPGNKYSAQ-----GERQIPVLQTNNGPSLMGLSTIATHLVKQASKE-HL 60

  Fly    84 YPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQ 148
            .....:::|::.|.|.|.::.:             :......|...|.|      ..|:.|:.:.
Mouse    61 LGSTAEEKAMVQQWLEFRVTRV-------------DGHSSKEDTQTLLK------DLNSYLEDKV 106

  Fly   149 YAALNKLTLADFALLATVSTF--EISEYDFGKYPEVVRWY 186
            |.|.:.:||||..|...:..|  :::..:..||..|.||:
Mouse   107 YLAGHNITLADILLYYGLHRFIVDLTVQEKEKYLNVSRWF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 13/55 (24%)
GstA 4..187 CDD:223698 37/170 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 22/100 (22%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 13/58 (22%)
Linker. /evidence=ECO:0000250 57..63 2/6 (33%)
C-terminal. /evidence=ECO:0000250 64..152 22/102 (22%)
GST_C_AIMP3 65..165 CDD:198338 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.