DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and eef1e1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:148 Identity:37/148 - (25%)
Similarity:58/148 - (39%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IPTLV-DDGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQ 116
            :|.|. ::|.|:.....|..:|. |..|...|...|.:||||:.|.|...::.|           
Zfish    29 VPVLQNNNGPALTGLVTIACHLV-KEAKRPELLGDDAEQRAVVQQWLEHRITKL----------- 81

  Fly   117 LFEDVKKPADPDNLKKIDDAFAM--FNTLLKGQQYAALNKLTLADFALLATVS--TFEISEYDFG 177
                       ||..|.:....:  .|..|:.:.|.|.|..||||..:...:.  ..|::..:..
Zfish    82 -----------DNCSKEEVKVILKDLNRYLEDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKE 135

  Fly   178 KYPEVVRWYDNAKKVIPG 195
            .|..|.||:|:.:. .||
Zfish   136 CYLNVSRWFDHIQH-YPG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 6/22 (27%)
GstA 4..187 CDD:223698 34/138 (25%)
GST_C_Delta_Epsilon 89..207 CDD:198287 27/111 (24%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.