DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gstr

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:207 Identity:48/207 - (23%)
Similarity:88/207 - (42%) Gaps:12/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMLYSAPCRSILMTARALGLELNK-KQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRA 68
            |:...|.||..:::......|:..| |.:..|..||..||...:||:..:||.......:.||.|
Zfish     8 YWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNESFA 72

  Fly    69 ILIYLAEKYDKDGS-LYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKK--PADPDNL 130
            ..:||...:...|: |.|.:|.:.|::.||:|...:...:.|...:|..|..:.::  .|...|.
Zfish    73 ACLYLESVFKSQGTRLIPDNPAEMALVYQRMFETENLQQKMYEVAFYDWLVPEGERLESALKRNK 137

  Fly   131 KKIDDAFAMFNTLL----KGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAK- 190
            :|:.:...::...|    || .|.|....::||......::.|...:....:.|.::.:|:..| 
Zfish   138 EKLIEELKLWEGYLEKMGKG-SYLAGKNFSMADVVCFPVIAYFPRLQCPKERCPRLMEYYEMVKD 201

  Fly   191 --KVIPGWEENW 200
              .:...|...|
Zfish   202 RPSIKASWPPEW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/70 (30%)
GstA 4..187 CDD:223698 44/189 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 23/121 (19%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 46/199 (23%)
GST_N_family 5..78 CDD:238319 20/69 (29%)
GST_C_family 99..199 CDD:198286 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.