DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gdap1l1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:266 Identity:51/266 - (19%)
Similarity:88/266 - (33%) Gaps:82/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|:...|...:.:.:.....||...::.|.|...|..:|.|:::|....:|..:.....:.:.
Zfish    48 LVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDY 112

  Fly    67 RAILIYLAEKY----------DKDGSLYPKDPQQRAVINQR----------LFFDLSTLYQSYVY 111
            ..|:.|:...:          |:...:|.:..|.|.:::..          |..:|:|  .|.:.
Zfish   113 NQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTT--DSMIP 175

  Fly   112 YY----------------------YPQLFED--------VKKPADPDN---LKKIDDAFAMFNTL 143
            .|                      .|||.|.        :.|..|.||   ||||....||    
Zfish   176 KYATAEIRRHLANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAM---- 236

  Fly   144 LKGQQYAALNK------------------LTLADFALLATVSTFEI-----SEYDFGKYPEVVRW 185
            :..|..|.|.|                  .||||..|.||:...:.     ..::.|..|.:..:
Zfish   237 VLDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLKFLGLSRKYWEDGSRPNLQSF 301

  Fly   186 YDNAKK 191
            ::..:|
Zfish   302 FERVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 14/72 (19%)
GstA 4..187 CDD:223698 49/258 (19%)
GST_C_Delta_Epsilon 89..207 CDD:198287 35/169 (21%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 51/266 (19%)
Thioredoxin_like 48..120 CDD:294274 14/71 (20%)
GST_C_GDAP1L1 201..311 CDD:198335 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.