Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 266 | Identity: | 51/266 - (19%) |
---|---|---|---|
Similarity: | 88/266 - (33%) | Gaps: | 82/266 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
Fly 67 RAILIYLAEKY----------DKDGSLYPKDPQQRAVINQR----------LFFDLSTLYQSYVY 111
Fly 112 YY----------------------YPQLFED--------VKKPADPDN---LKKIDDAFAMFNTL 143
Fly 144 LKGQQYAALNK------------------LTLADFALLATVSTFEI-----SEYDFGKYPEVVRW 185
Fly 186 YDNAKK 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 14/72 (19%) |
GstA | 4..187 | CDD:223698 | 49/258 (19%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 35/169 (21%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 51/266 (19%) |
Thioredoxin_like | 48..120 | CDD:294274 | 14/71 (20%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 28/111 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589627 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |