DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gdap1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:175 Identity:41/175 - (23%)
Similarity:65/175 - (37%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|:...|...:.:.:.....||:.....|.|...||.:|.|:::||...:|.||.|...|.:.
Zfish    40 LILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICDP 104

  Fly    67 RAILIYLAEKY---------DKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVK 122
            ..|:.||.:.:         .::||.|....|....:...|..|..|    :....:|::..|..
Zfish   105 TQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYT----HGCILHPEITVDSH 165

  Fly   123 KPA------------DPDNLKKIDDAFAMFNTLLKGQQYAALNKL 155
            .||            ....|||:    |:.|..||....|...:|
Zfish   166 IPAYATTHIRTQIGNTESELKKL----AVENPDLKDAYIAKQRRL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/72 (29%)
GstA 4..187 CDD:223698 40/173 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 17/79 (22%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 41/175 (23%)
GST_N_GDAP1 40..112 CDD:239350 20/71 (28%)
GST_C_family 193..304 CDD:295467 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.