DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gsta6

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001019532.1 Gene:Gsta6 / 501110 RGDID:1565402 Length:222 Species:Rattus norvegicus


Alignment Length:189 Identity:50/189 - (26%)
Similarity:87/189 - (46%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FYYMLYSAPCRSILMTARALGLELNKKQV----DLDAGEHLKPEFVKINPQHTIPTLVDDGFAIW 64
            |:|........|:.....|.|:|..:|.:    ||   |.|:.:.|.:..|  :|.:..||..:.
  Rat     7 FHYDEARGRMESVRWLLAAAGVEYEEKFIHTNEDL---EKLRSDGVLMFQQ--VPMVEVDGMKLV 66

  Fly    65 ESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFD-LSTLYQSYVYYYYPQLFEDVKKPADPD 128
            ::|||:.|.:.||    :||.||.::||:|:  ::.: |:.|.:.::.|           |.||.
  Rat    67 QTRAIMNYFSSKY----NLYGKDMKERALID--MYSEGLADLNEMFILY-----------PFDPP 114

  Fly   129 NLKKIDDA----------FAMFNTLLK--GQQYAALNKLTLADFALLATVSTFEISEYD 175
            .:|:.:.|          |..|..:.:  ||.|...|||:.||..|:..:  :.:.|.|
  Rat   115 GVKEANIALMKEKATNRYFPAFEKVFESHGQDYLVGNKLSKADVHLVEMI--YNMEELD 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 20/74 (27%)
GstA 4..187 CDD:223698 50/189 (26%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/100 (24%)
Gsta6NP_001019532.1 Thioredoxin_like 4..82 CDD:412351 22/83 (27%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P30711 54..55 1/2 (50%)